Teriparatide
FDA ApprovedTeriparatide
An FDA-approved PTH analog researched for bone density improvement. One of the few anabolic bone treatments that actually builds new bone rather than just preventing loss.
Dose
20 mcg
Route
SubQ injection
Cycle
Up to 24 months
Storage
Supplied as a refrigerated solution in a prefilled pen rather than a lyophilized powder; store at 2-8°C, never frozen, and protect from light.
What is Teriparatide?
Teriparatide is a recombinant human parathyroid hormone (PTH) analog, specifically the N-terminal 34 amino acids of native human PTH. It is researched as an anabolic agent for bone, meaning it stimulates new bone formation, in contrast to many other osteoporosis treatments that primarily slow bone resorption. Its mechanism involves intermittent activation of PTH1 receptors on osteoblasts, leading to increased bone turnover with a net anabolic effect. Teriparatide is FDA-approved for the treatment of osteoporosis in various populations due to its ability to significantly increase bone mineral density and reduce the risk of fractures.
Key Benefits
- Bone density improvement
- Fracture risk reduction
- Anabolic bone formation
- Osteoporosis treatment
Mechanism of Action
- PTH(1-34) receptor agonist
- Activates osteoblasts (bone-building cells)
- Net anabolic effect on bone with intermittent dosing
Best For
- Bone density research
- Osteoporosis research
- Aging research
Body Systems
🐾 Griffin Says...
Molecular Information
Molecular weight
4117.8 g/mol
Length
34 amino acids
Type
Peptide
Amino acid sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
N-terminal 34 amino acids of human parathyroid hormone (PTH(1-34))
Pharmacokinetics
Time to peak
Approximately 30 minutes
Half-life
1 h
Time to clear
Within 3 hours
Widely cited in pharmaceutical and clinical pharmacology literature.
Research Indications
Severe Osteoporosis Treatment
Extensively researched and approved for the treatment of osteoporosis in postmenopausal women and men at high risk of fracture.
Glucocorticoid-Induced Osteoporosis
Researched for increasing bone mineral density in men and women with osteoporosis associated with sustained systemic glucocorticoid therapy.
Research Protocols
| Goal | Dose | Frequency | Route |
|---|---|---|---|
| Osteoporosis Treatment (Standard Protocol) | 20 mcg | Once daily | Subcutaneous injection |
| Monitoring Bone Turnover Markers | N/A (diagnostic protocol) | Periodically (e.g., at 3, 6, 12 months) | Blood sample |
| Assessing Bone Mineral Density (BMD) | N/A (diagnostic protocol) | Annually or biennially | DEXA scan |
| Managing Transient Hypercalcemia | Monitor calcium levels; possibly adjust timing or discontinue if severe | Regularly | Blood sample |
Daily administration is crucial for its anabolic effects; continuous exposure to PTH would lead to catabolic effects (bone breakdown).
Peptide Interactions
- Use Caution
Digoxin
Hypercalcemia caused by teriparatide may predispose to digoxin toxicity. Close monitoring of serum calcium and digoxin levels is commonly discussed.
- Use Caution
Diuretics (Thiazide)
Thiazide diuretics can reduce renal calcium excretion, potentially leading to hypercalcemia, especially when co-administered with teriparatide. Monitoring of serum calcium is advised.
- Compatible
Bisphosphonates
While used in sequence, concurrent use of bisphosphonates with teriparatide is not typically recommended in initial treatment, as it may attenuate the anabolic effects of teriparatide. Sequential therapy (teriparatide followed by bisphosphonates) is commonly discussed.
- Compatible
Calcium and Vitamin D Supplements
Adequate intake of calcium and vitamin D is commonly recommended during teriparatide therapy to support bone health, but excessive supplementation should be avoided due to hypercalcemia risk.
- Monitor Combination
Other PTH analogs or agents affecting calcium homeostasis
Concurrent use with other compounds that significantly impact calcium or phosphate metabolism (e.g., calcitonin) should be carefully monitored due to potential additive effects on serum electrolytes.
How to Reconstitute
What to Expect
- Weeks 1-4: May experience mild transient side effects such as nausea, dizziness, or leg cramps. These often subside with continued use.
- Months 3-6: Initial biochemical markers of bone formation (e.g., bone-specific alkaline phosphatase, procollagen type 1 N-terminal propeptide) may show increases, indicating active bone remodeling.
- Months 6-12: Increases in bone mineral density (BMD) at the lumbar spine and hip can typically be observed via DEXA scans.
- Months 12-24: Continued improvements in BMD are expected, along with a reduction in fracture risk. The maximum duration of treatment is generally limited to 24 months due to safety considerations observed in animal studies.
Side Effects & Safety
| Effect | Frequency | Severity |
|---|---|---|
| Nausea | Common | Mild |
| Dizziness | Uncommon | Mild |
| Leg cramps | Uncommon | Mild |
| Theoretical osteosarcoma risk (animal data) | Not seen in humans at clinical doses | Note |
Ready to calculate your dose? Use Griffin's Peptide Calculator 🐾
Open CalculatorPeptides discussed here are for research purposes only. Nothing on this page is medical advice. Always consult a qualified professional before making health decisions.