Mazdutide
Clinical TrialsMazdutide
A GLP-1 and glucagon dual receptor agonist from China's Innovent Biologics. Researched for weight loss and type 2 diabetes with promising Phase 3 trial data.
Dose
1 mg to 9 mg
Route
SubQ injection
Cycle
Typically 24 to 48 weeks, or as determined by research protocol
Storage
Store refrigerated at 2°C to 8°C (36°F to 46°F), protected from light.
What is Mazdutide?
Mazdutide is an investigational dual agonist of the glucagon-like peptide-1 (GLP-1) and glucagon receptors, developed by Innovent Biologics. It is being researched for its potential in managing type 2 diabetes and obesity. The peptide's unique structure, including a fatty acid modification, allows for once-weekly subcutaneous administration. Research indicates that mazdutide promotes weight reduction, improves glycemic control, and can reduce liver fat, acting through both GLP-1-mediated appetite suppression and glucagon-mediated energy expenditure.
Key Benefits
- Weight reduction
- Blood sugar control
- Appetite suppression
- Liver fat reduction
- Dual receptor activity
Mechanism of Action
- Dual GLP-1 and glucagon receptor agonism
- Enhances fat burning through glucagon pathway
- Reduces appetite via GLP-1
- Weekly dosing schedule
Best For
- Weight management research
- Metabolic health
- Type 2 diabetes research
Body Systems

🐾 Griffin Says...
Molecular Information
Molecular weight
4880.5 g/mol
Length
42 amino acids
Type
Peptide
Amino acid sequence
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKGGGK
This sequence represents the known 42-amino acid structure of Mazdutide. The C-terminus is amidated, and there are specific modifications, including a C20 fatty acid chain attached via a linker to the Lys residue at position 42, which are crucial for its prolonged half-life and dual agonism.
Pharmacokinetics
Time to peak
Approximately 24-72 hours
Half-life
168 h
Time to clear
Approximately 4-5 weeks to reach steady state after initiation, and similar duration for full clearance after cessation.
Based on pharmacokinetic data presented in clinical trials and peer-reviewed literature for similar long-acting GLP-1/glucagon receptor co-agonists.
Research Indications
Obesity and Overweight
Research indicates significant and dose-dependent weight loss in individuals with obesity or who are overweight with comorbidities. Mazdutide's dual agonism may contribute to enhanced fat burning and appetite suppression.
Body Composition Improvement
Studies suggest that weight loss observed with Mazdutide is primarily due to a reduction in fat mass, contributing to improved body composition.
Research Protocols
| Goal | Dose | Frequency | Route |
|---|---|---|---|
| Weight Loss in Obese/Overweight Adults | Starting at 1 mg once weekly, escalating by 1 mg increments every 4 weeks to a maximum of 9 mg once weekly (or highest tolerated dose). | Once weekly | Subcutaneous (SC) |
| Glycemic Control in Type 2 Diabetes | Starting at 1 mg once weekly, escalating by 1 mg increments every 4 weeks to a target maintenance dose (e.g., 6 mg or 9 mg once weekly) based on glycemic response and tolerability. | Once weekly | Subcutaneous (SC) |
| Reduction of Liver Fat in NAFLD/MASLD | Dose escalation protocol similar to weight loss studies, targeting higher maintenance doses (e.g., 6 mg or 9 mg once weekly) for efficacy. | Once weekly | Subcutaneous (SC) |
| Long-term Safety and Efficacy Evaluation | Maintenance dose determined from initial titration (e.g., 6 mg or 9 mg once weekly) for an extended period (e.g., 48 weeks or longer). | Once weekly | Subcutaneous (SC) |
Research protocols commonly involve a dose-escalation phase to mitigate potential gastrointestinal side effects, starting with a lower dose and gradually increasing to the target maintenance dose over several weeks.
Peptide Interactions
- Monitor Combination
Insulin secretagogues (e.g., sulfonylureas)
Concomitant use may increase the risk of hypoglycemia. Dose adjustment of the insulin secretagogue may be required.
- Monitor Combination
Insulin
Concurrent administration may increase the risk of hypoglycemia. Lowering the dose of insulin may be necessary.
- Monitor Combination
Oral Medications
Mazdutide, as a GLP-1 receptor agonist, can delay gastric emptying. This may affect the absorption of orally administered medications, potentially requiring dosage adjustments or altered timing of administration for highly time-sensitive drugs.
- Avoid
Other GLP-1 Receptor Agonists
Co-administration with other GLP-1 receptor agonists is not recommended due to increased risk of side effects and lack of additional benefit.
- Use Caution
Alcohol
Alcohol can lower blood glucose and may interact with Mazdutide's effects on glycemic control. Moderate alcohol consumption is generally advised in research settings.
How to Reconstitute
- 1Ensure all materials (vial of Mazdutide, bacteriostatic water for injection, sterile syringes, and alcohol wipes) are at room temperature.
- 2Swab the rubber stopper of the Mazdutide vial and the bacteriostatic water vial with alcohol wipes and allow to air dry.
- 3Draw the appropriate amount of bacteriostatic water for injection into a sterile syringe (commonly 1 mL per vial, or as per specific instructions).
- 4Slowly inject the bacteriostatic water into the Mazdutide vial, directing the stream against the inside wall of the vial to prevent foaming.
- 5Gently swirl the vial until the powder is completely dissolved. Do not shake vigorously, as this can degrade the peptide.
- 6Visually inspect the solution for any particulate matter or discoloration. It should be clear and colorless. If not, discard.
What to Expect
- Weeks 1-4: Initial weight loss may be modest. Gastrointestinal side effects like nausea and constipation are most common during dose escalation.
- Weeks 5-12: More noticeable reductions in body weight and improvements in glycemic parameters typically begin. Side effects may lessen as the body adapts.
- Weeks 13-24: Continued progression towards target weight loss and sustained improvements in blood glucose control are commonly observed.
- Weeks 25-48+: Maintenance of weight loss and metabolic improvements, with ongoing monitoring for long-term efficacy and safety.
- During the entire research period: Regular monitoring of blood glucose, HbA1c, body weight, and potential adverse events is standard.
Side Effects & Safety
| Effect | Frequency | Severity |
|---|---|---|
| Nausea | Common | Mild |
| Vomiting | Uncommon | Mild |
| Diarrhea | Common | Mild |
Ready to calculate your dose? Use Griffin's Peptide Calculator 🐾
Open CalculatorPeptides discussed here are for research purposes only. Nothing on this page is medical advice. Always consult a qualified professional before making health decisions.