Liraglutide
FDA ApprovedLiraglutide
An FDA-approved GLP-1 receptor agonist. Developed by Novo Nordisk for type 2 diabetes, also approved for chronic weight management under the brand name Saxenda.
Dose
0.6 mg to 3.0 mg
Route
SubQ injection
Cycle
Ongoing as needed for research objectives
Storage
Not applicable; Liraglutide is supplied as a solution.
What is Liraglutide?
Liraglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist that shares 97% amino acid sequence homology with endogenous human GLP-1. Its prolonged action, with a half-life of approximately 13 hours, allows for once-daily dosing. This extended duration is due to its acylation, which facilitates binding to albumin, protecting it from degradation by dipeptidyl peptidase-4 (DPP-4) and neutral endopeptidases. In research contexts, Liraglutide is studied for its ability to enhance glucose-dependent insulin secretion, suppress glucagon secretion, slow gastric emptying, and reduce appetite, leading to improvements in glycemic control and body weight.
Key Benefits
- Weight reduction
- Blood sugar control
- Appetite suppression
- Cardiovascular benefits
- Kidney protection research
Mechanism of Action
- GLP-1 receptor agonist
- Slows gastric emptying
- Reduces appetite
- Increases insulin secretion
Best For
- Weight management research
- Type 2 diabetes research
- Metabolic health
Body Systems
🐾 Griffin Says...
Molecular Information
Molecular weight
3751.2 Da
Length
31 amino acids
Type
Acylated GLP-1 Analog
Amino acid sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG-COOH (with a C16 fatty acid chain attached via a glutamyl spacer to Lys26)
The sequence is based on human GLP-1(7-37) with specific modifications: Arg34 for Lys34 and the attachment of a C16 fatty acid chain (palmitic acid) via a glutamyl linker at Lys26.
Pharmacokinetics
Time to peak
8-12 hours
Half-life
13 h
Time to clear
Approximately 2-3 days
Based on published pharmacokinetic studies of Liraglutide.
Research Indications
Chronic Weight Management
Liraglutide is extensively studied for its efficacy in promoting significant and sustained weight loss in individuals with obesity or overweight with comorbidities, often in conjunction with diet and exercise.
Appetite Suppression
Research indicates Liraglutide's role in reducing appetite and caloric intake by acting on central GLP-1 receptors, contributing to its weight-reducing effects.
Research Protocols
| Goal | Dose | Frequency | Route |
|---|---|---|---|
| Weight Management in Obese/Overweight Subjects | Initiate at 0.6 mg daily for 1 week, then escalate by 0.6 mg increments weekly to a target maintenance dose of 3.0 mg daily. | Daily | Subcutaneous injection |
| Glycemic Control in Type 2 Diabetes | Initiate at 0.6 mg daily for 1 week, then escalate to 1.2 mg daily. If further glycemic control is needed, increase to 1.8 mg daily. | Daily | Subcutaneous injection |
| Cardiovascular Outcome Studies | 1.8 mg daily (typically the highest dose approved for diabetes in some regions, though 3.0 mg is for weight management) | Daily | Subcutaneous injection |
| Investigation of Gastrointestinal Side Effect Profile | Gradual dose escalation starting from 0.3 mg or 0.6 mg, with careful monitoring of adverse events at each step. | Daily | Subcutaneous injection |
| Comparative Efficacy with Other GLP-1 Receptor Agonists | Dose adjusted to achieve optimal therapeutic effect as per comparison arm, e.g., 1.8 mg or 3.0 mg daily. | Daily | Subcutaneous injection |
For research protocols involving dose escalation, the dose is typically increased gradually over several weeks to minimize gastrointestinal side effects.
Peptide Interactions
- Monitor Combination
Sulfonylureas or Insulin
When Liraglutide is co-administered with sulfonylureas or insulin, the risk of hypoglycemia may increase. Research protocols commonly involve a reduction in the dose of the sulfonylurea or insulin to mitigate this risk.
- Use Caution
Oral Medications (e.g., Warfarin, Digoxin)
Liraglutide slows gastric emptying, which could potentially affect the absorption of concomitantly administered oral medications. While no clinically significant interaction has been observed for most, caution and monitoring are warranted, especially for drugs with a narrow therapeutic index.
- Monitor Combination
Glucocorticoids
Glucocorticoids can increase blood glucose levels. If a research subject is on glucocorticoids, Liraglutide's glucose-lowering effect might be attenuated, requiring careful monitoring and potential dose adjustment of Liraglutide or other antidiabetic agents.
- Monitor Combination
Diuretics
Some diuretics can cause electrolyte imbalances or affect renal function. Given the rare reports of renal impairment with Liraglutide, careful monitoring of renal function and hydration status is advised when co-administering with diuretics in research.
- Compatible
Thyroid Hormones
No direct interaction affecting the efficacy or safety of Liraglutide or thyroid hormones has been widely reported. However, given Liraglutide's potential impact on thyroid C-cells in animal studies, ongoing monitoring for thyroid abnormalities may be prudent in long-term research.
How to Reconstitute
- 1Verify the pre-filled pen for Liraglutide is at room temperature for optimal comfort.
- 2Inspect the solution for clarity and absence of particles. It should be clear and colorless.
- 3Attach a new, sterile needle to the pen according to the manufacturer's instructions.
- 4Perform a 'flow check' by dialing 2 units and pressing the dose button to ensure a drop appears at the needle tip, indicating proper flow.
- 5Dial the desired research dose on the pen according to the specific protocol.
- 6Administer the dose by inserting the needle into the designated subcutaneous injection site and pressing the dose button fully, holding it for 6 seconds after the dose counter returns to 0.
What to Expect
- Weeks 1-4: Research subjects may experience initial gastrointestinal side effects (nausea, vomiting, diarrhea, constipation) as the dose is gradually increased.
- Weeks 4-12: Reductions in appetite and potential early signs of weight loss may become apparent.
- Months 3-6: More significant weight loss and improvements in glycemic control, if applicable, are commonly observed.
- Beyond 6 months: Continued weight management and sustained improvements in metabolic parameters are often the focus of long-term research protocols.
- Throughout: Regular monitoring of blood glucose levels (if applicable) and body weight is standard practice.
Side Effects & Safety
| Effect | Frequency | Severity |
|---|---|---|
| Nausea | Very Common | Mild-Moderate |
| Vomiting | Common | Mild |
| Diarrhea | Common | Mild |
Ready to calculate your dose? Use Griffin's Peptide Calculator 🐾
Open CalculatorPeptides discussed here are for research purposes only. Nothing on this page is medical advice. Always consult a qualified professional before making health decisions.