Cagrilintide
Clinical TrialsCagrilintide
A long-acting amylin analog researched for weight loss, particularly in combination with semaglutide (the CagriSema combination).
Dose
0.16 mg to 2.4 mg
Route
SubQ injection
Cycle
Ongoing in research, typically 26-68 weeks in clinical trials
Storage
Lyophilized powder vial: store sealed at 2-8°C (refrigerated) for long-term use, protected from light. Stable at room temperature for short periods during shipping; -20°C for storage beyond 24 months.
What is Cagrilintide?
Cagrilintide is a long-acting amylin analog being researched for its potential in weight management and metabolic health. As an amylin receptor agonist, it mimics the actions of naturally occurring amylin, a hormone co-secreted with insulin from pancreatic beta cells. Its primary mechanisms of action involve slowing gastric emptying, promoting satiety by acting on the central nervous system, and reducing food intake. Cagrilintide is particularly noted for its potential synergistic effects when combined with GLP-1 receptor agonists, such as semaglutide, in a co-formulation (CagriSema), leading to enhanced weight loss outcomes. Research suggests it contributes to significant reductions in body weight, improvements in glycemic control, and overall metabolic health in individuals with obesity or overweight.
Key Benefits
- Weight reduction
- Appetite suppression
- Complementary to GLP-1 agonists
- Blood sugar regulation
- Satiety improvement
Mechanism of Action
- Amylin receptor agonist
- Slows gastric emptying
- Reduces appetite via CNS
- Synergistic with GLP-1 receptor agonists
Best For
- Advanced weight management research
- Combination therapy research
Body Systems
🐾 Griffin Says...
Molecular Information
Molecular weight
4212.8 Da
Length
34 amino acids
Type
Amylin analog
Amino acid sequence
KCNTATCATQRLANFLVRSSNNLGPVLPPKPTY
A synthetic analog of human amylin with modifications for extended half-life.
Pharmacokinetics
Time to peak
10-24 hours
Half-life
168 h
Time to clear
Approximately 4-5 weeks to reach steady state, and similar time to clear after discontinuation due to long half-life
Clinical trial data and pharmacokinetic studies.
Research Indications
Obesity and Overweight with Comorbidities
Research indicates significant body weight reduction in individuals with obesity or who are overweight with weight-related comorbidities.
Appetite Regulation and Satiety
Studies show enhanced feelings of fullness and reduced caloric intake through central and peripheral mechanisms.
Research Protocols
| Goal | Dose | Frequency | Route |
|---|---|---|---|
| Weight Reduction in Obese/Overweight Subjects | 0.16 mg, escalating to 2.4 mg weekly | Once weekly | Subcutaneous |
| Evaluation of CagriSema (Cagrilintide + Semaglutide) for Weight Loss | Cagrilintide 2.4 mg + Semaglutide 2.4 mg weekly | Once weekly | Subcutaneous |
| Assessment of Glycemic Control in Type 2 Diabetes | 0.16 mg to 2.4 mg weekly (monotherapy or add-on) | Once weekly | Subcutaneous |
| Pharmacokinetic and Pharmacodynamic Studies | Varies by study design (e.g., single dose, repeated doses) | Varies | Subcutaneous |
| Long-term Safety and Efficacy in Weight Management | Target dose of 2.4 mg weekly, with potential for dose escalation | Once weekly | Subcutaneous |
Injection timing for cagrilintide is flexible due to its long half-life, allowing for once-weekly administration. Consistency in the day of the week for injection is commonly discussed in research protocols.
Peptide Interactions
- Synergistic
GLP-1 Receptor Agonists (e.g., Semaglutide, Liraglutide)
Cagrilintide and GLP-1 RAs have complementary mechanisms for weight loss and glycemic control, often researched together (e.g., CagriSema) for enhanced effects.
- Monitor Combination
Insulin
Cagrilintide can lower blood glucose. If used concurrently with insulin, the insulin dose may need adjustment to prevent hypoglycemia. Careful blood glucose monitoring is advised.
- Monitor Combination
Sulfonylureas
Similar to insulin, sulfonylureas stimulate insulin release. Concurrent use with cagrilintide may increase the risk of hypoglycemia, necessitating dose adjustments and monitoring.
- Use Caution
Oral Medications with Narrow Therapeutic Index
Cagrilintide slows gastric emptying, which could potentially alter the absorption rate of co-administered oral medications. Monitor efficacy of such medications carefully.
- Avoid
Other Amylin Analogs (e.g., Pramlintide)
Due to similar mechanisms of action, concurrent use is not typically recommended and may increase the risk of side effects without additional benefit. Consult specific research protocols.
- Monitor Combination
Alcohol
Alcohol consumption can affect blood glucose levels and gastric emptying. While not a direct interaction, it is advisable to monitor effects when consuming alcohol while on cagrilintide.
How to Reconstitute
- 1Verify the concentration and solvent required as per specific research protocol.
- 2If in lyophilized form, aseptically draw the required volume of bacteriostatic water for injection (BWFI) into a sterile syringe.
- 3Inject the BWFI into the vial containing the lyophilized peptide, directing the stream to the side of the vial to prevent foaming.
- 4Gently swirl the vial to dissolve the peptide completely. Do not shake vigorously.
- 5Visually inspect the solution for any particulate matter or discoloration. The solution should be clear and colorless.
What to Expect
- Weeks 1-4: Initial subtle changes in appetite and potentially minor gastrointestinal side effects (e.g., nausea).
- Weeks 4-12: More noticeable reduction in appetite and increased satiety, contributing to early stages of weight loss.
- Weeks 12-24: Continued progression of weight loss, stabilization of appetite control. Potential for dose escalation under research guidance.
- Weeks 24+: Sustained weight management and metabolic improvements, especially when combined with lifestyle interventions.
Side Effects & Safety
| Effect | Frequency | Severity |
|---|---|---|
| Nausea | Common | Mild |
| Vomiting | Uncommon | Mild |
| Injection site reactions | Common | Mild |
Ready to calculate your dose? Use Griffin's Peptide Calculator 🐾
Open CalculatorPeptides discussed here are for research purposes only. Nothing on this page is medical advice. Always consult a qualified professional before making health decisions.